PERSPECTA

News from every angle

Results for "GTA 6"

200 stories found

Rockstar Unveils First GTA 6 Gameplay Trailer in Netflix Special
TechnologyThe Guardianyle-uutisetder-spiegel+10le-figarola-repubblicaorftelexvgel-mundoforbesindex-hr+2 more3h ago13 sources

Rockstar Unveils First GTA 6 Gameplay Trailer in Netflix Special

Rockstar Games has released the first official gameplay trailer for Grand Theft Auto VI through a dedicated Netflix special, revealing the game's setting, mechanics, and story elements. The broadcast drew unprecedented viewership, triggering temporary outages and traffic surges across streaming platforms including Twitch and Netflix.

Rockstar Condemns Heartbreaking Grand Theft Auto VI Gameplay Leaks
CultureBBCFox Newsle-figaro+8vgel-mundoforbeshindustan-timesthe-journaligntempo-englishscreen-rant1d ago11 sources

Rockstar Condemns Heartbreaking Grand Theft Auto VI Gameplay Leaks

Rockstar Games has officially condemned recent unauthorized leaks of Grand Theft Auto VI gameplay footage and story spoilers, describing the breaches as heartbreaking for its development team. The studio warned players that the premature exposure could negatively impact the intended narrative experience upon the game's release.

GTA VI Leaks Continue, Rockstar to Air Netflix Program
Technologybloomberghelsingin-sanomatla-vanguardia+1myjoyonline5d ago4 sources

GTA VI Leaks Continue, Rockstar to Air Netflix Program

Numerous videos of the highly anticipated game Grand Theft Auto VI have been leaked online, causing significant disruption and disappointment for developer Rockstar Games. The leaks have revealed early development footage, and Rockstar is also set to release a half-hour program on Netflix to showcase the game.

KPop Demon Hunters Expands with New Game and Faces Lawsuit
Culturescreen-rant7d ago

KPop Demon Hunters Expands with New Game and Faces Lawsuit

The KPop Demon Hunters franchise is expanding with a new open-world game ahead of its 2029 Netflix sequel, but is also facing a lawsuit alleging exploitation. The series has been noted for its unique blend of KPop and demon hunting themes.

GTA 6 Fans Debate New Logo Design
Culturescreen-rant26d ago

GTA 6 Fans Debate New Logo Design

Grand Theft Auto 6 is introducing a new logo, departing from franchise tradition, which has sparked a furious debate among fans who are divided on their preference.

GTA 6 Story Length Divides Fans
Culturescreen-rant1mo ago

GTA 6 Story Length Divides Fans

Fans of Grand Theft Auto 6 are divided over the official story length of the upcoming action-adventure game, with many agreeing it won't be short but unsure how they feel about its specific duration.

Analyst Suggests GTA 6 Should Cost $200
Cultureign1mo ago

Analyst Suggests GTA 6 Should Cost $200

An analyst has suggested that Rockstar's upcoming Grand Theft Auto 6, priced at $80, is significantly undervalued and should cost $200, calling it 'The Last Great Game' before AI-driven development.

Rockstar Releases Extended GTA 6 Trailer via Netflix, Sparking Global Reaction
CultureBBCbloomberghelsingin-sanomat+10nossydney-morning-heraldvarietyiefimeridanewsbeastgulf-newsignenews+2 more2h ago13 sources

Rockstar Releases Extended GTA 6 Trailer via Netflix, Sparking Global Reaction

Rockstar Games has released a 27-minute extended gameplay trailer for Grand Theft Auto VI via Netflix, providing the first comprehensive look at the long-awaited title. The reveal has sparked intense global discussion over its graphics, mechanics, and side activities.

Leaked GTA VI Footage Reveals Protagonist Lucia and Early Gameplay
Cultureignscreen-rant1d ago2 sources

Leaked GTA VI Footage Reveals Protagonist Lucia and Early Gameplay

Recently leaked gameplay footage from Grand Theft Auto VI offers the first detailed look at protagonist Lucia and suggests how the opening sequence may unfold. The clips have generated significant discussion among gaming communities ahead of the official release.

NBA 2K27 Teases GTA 6 Collaboration Event
Cultureign2d ago

NBA 2K27 Teases GTA 6 Collaboration Event

NBA 2K27 is hinting at a Grand Theft Auto 6-themed event in collaboration with Rockstar Games. This comes as global release times for an extended look at GTA 6 have also been confirmed.

GTA 6 Leaker Continues to Release Footage
Technologyforbes5d ago

GTA 6 Leaker Continues to Release Footage

The individual responsible for leaking Grand Theft Auto 6 footage is reportedly continuing to release new content, including from a strip club, as Rockstar Games attempts to manage the situation.

Opinion: GTA 6 should borrow from GTA 4
Cultureign12d ago

Opinion: GTA 6 should borrow from GTA 4

An IGN writer expresses hope that Rockstar Games will incorporate elements from Grand Theft Auto 4 into the upcoming Grand Theft Auto 6, based on a recent replay of the 2008 title.

Take-Two CEO Defends GTA 6 Digital-First Release and Pricing
Cultureforbeschannel-news-asiaign+1screen-rant20d ago4 sources

Take-Two CEO Defends GTA 6 Digital-First Release and Pricing

Take-Two CEO Strauss Zelnick defended the decision for a digital-first release of Grand Theft Auto 6, comparing physical releases to vinyl records, and stated that the game's pricing reflects inflation. He also noted unprecedented pre-orders while maintaining booking targets.

Take-Two confirms GTA 6 release date on track
Cultureign20d ago

Take-Two confirms GTA 6 release date on track

Rockstar owner Take-Two has confirmed that the November 19 release date for Grand Theft Auto VI is still on schedule, stating that an upcoming 'Extended Look' will boost consumer anticipation.

Concerns Rise Over Potential GTA 6 Delay
Culturenmescreen-rant21d ago2 sources

Concerns Rise Over Potential GTA 6 Delay

Fears are growing that 'Grand Theft Auto VI' could face a last-minute delay, despite what seemed like a clear path to its release. A former developer has indicated that another postponement would not be surprising.

GTA 6 File Size Worries Gamers
Culturescreen-rant1mo ago

GTA 6 File Size Worries Gamers

An official update regarding GTA 6 has caused concern among gamers, specifically due to information about the game's file size, despite many details about the game still being unknown.

GTA 6 Framerate Details Excite Fans
Culturescreen-rant1mo ago

GTA 6 Framerate Details Excite Fans

New details regarding the framerates for the upcoming Grand Theft Auto 6 have emerged, generating significant excitement among fans for its performance across various hardware.

Gaming Industry Debates Future of Physical Discs Amidst Digital Shift
Cultureign1mo ago

Gaming Industry Debates Future of Physical Discs Amidst Digital Shift

The gaming industry is facing a debate over the future of physical game discs, as PlayStation moves towards an all-digital future while Xbox highlights the availability of physical discs for its titles. A significant majority of gamers surveyed by IGN expressed a preference against an all-digital future.

Concerns Over GTA 6's Impact on Gaming Industry
Culturescreen-rant2mo ago

Concerns Over GTA 6's Impact on Gaming Industry

Despite its unprecedented popularity, Grand Theft Auto 6 is reportedly setting a dangerous new precedent for the gaming industry, with even diehard fans expressing concern over Rockstar's choices.

Take-Two Pursues Legal Action Against GTA 6 Leakers
Technologyder-standard3d ago

Take-Two Pursues Legal Action Against GTA 6 Leakers

Take-Two Interactive, parent company of Rockstar Games, has initiated legal proceedings against individuals responsible for leaking 'Grand Theft Auto 6' content. The company has requested information from Microsoft, Google, and other platforms to identify the leakers.

TikTok Settles US Children's Privacy Case for $400 Million
BusinessAPReutersBBC+66bloombergNYTwsjle-mondewapoThe GuardianAl JazeeraCNN+58 more5d ago69 sources

TikTok Settles US Children's Privacy Case for $400 Million

TikTok has agreed to pay a $400 million settlement to the US Justice Department, resolving investigations into the company's handling of children's privacy data. This agreement concludes the legal battle regarding the collection of personal information from minors on the platform.

Take-Two Subpoenas Microsoft and Discord in Hunt for GTA 6 Leaker
Cultureforbesvarietyign6d ago3 sources

Take-Two Subpoenas Microsoft and Discord in Hunt for GTA 6 Leaker

Take-Two Interactive, parent company of Rockstar Games, has issued subpoenas to Microsoft and Discord in its ongoing search for the individual responsible for leaking Grand Theft Auto VI footage. The company is seeking information to identify the leaker.

GTA 6 Potentially Banned in Australia
Technologyvijesti-me9d ago

GTA 6 Potentially Banned in Australia

A new decision by Australian regulators has raised concerns that the upcoming video game Grand Theft Auto 6 could be banned in the country due to problematic content.

Concerns Rise Over Potential GTA VI Delay
Technologyignzerohedge22d ago2 sources

Concerns Rise Over Potential GTA VI Delay

Fears of a potential delay for Grand Theft Auto VI have resurfaced after a former Rockstar developer stated he 'would not be shocked' if the game was postponed. This follows an actor's revelation of auditioning for 60 roles without hearing back from Rockstar.

GTA 6 Release Date Confirmed, Raising Concerns for Other Games
Culturescreen-rant1mo ago

GTA 6 Release Date Confirmed, Raising Concerns for Other Games

Grand Theft Auto 6 has officially been given an expiration date, confirming its release window and potentially creating a major problem for other upcoming game titles. This announcement has sparked discussions about the competitive landscape for new releases.

GTA 6 Online Teaser Excites Gamers
Culturescreen-rant1mo ago

GTA 6 Online Teaser Excites Gamers

A teaser for Grand Theft Auto 6 Online has been released, causing excitement among gamers who are anticipating future surprises for the game.

Grand Theft Auto 6 Weapons Revealed
Culturescreen-rant1mo ago

Grand Theft Auto 6 Weapons Revealed

Details about the weapons confirmed so far for the upcoming video game Grand Theft Auto 6 have been revealed, with more expected to be shown in future gameplay.

Egypt Coach Alleges Injustice After World Cup Loss to Argentina
CultureBBCbloombergNYT+59FTle-mondeThe GuardianNPRAl JazeeraFox NewsfazDW+51 more1mo ago62 sources

Egypt Coach Alleges Injustice After World Cup Loss to Argentina

Egypt's coach, Hassan, accused officials of unfair treatment and bias towards Lionel Messi after his team squandered a two-goal lead and lost 3-2 to Argentina, leading to their exit from the World Cup. The controversial defeat sparked fury and heartbreak among Egyptian fans and the team.

Sony to End PlayStation Physical Game Production by 2028
CultureBBCThe Guardiandr-dk+33nrkyle-uutisetcnbchelsingin-sanomatnosfazberlingskeDW+25 more1mo ago36 sources

Sony to End PlayStation Physical Game Production by 2028

Sony has announced that it will cease the production of physical PlayStation game discs by 2028, transitioning entirely to digital downloads. This move signals the end of an era for physical media in PlayStation gaming.

GTA 6 Free Giveaway Stuns Gamers
Culturescreen-rant1mo ago

GTA 6 Free Giveaway Stuns Gamers

An unexpected free giveaway for the highly anticipated Grand Theft Auto 6 has reportedly left a large number of gamers surprised and excited.

GTA 6 Faces Potential Ban in Russia
Culturescreen-rant2mo ago

GTA 6 Faces Potential Ban in Russia

Grand Theft Auto VI is facing a potential ban in Russia due to concerns over immoral content, which could render the game unplayable for millions of players in the country.